PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_016515921.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
Family MYB_related
Protein Properties Length: 265aa    MW: 28912.6 Da    PI: 9.6125
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_016515921.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding43.57.3e-14100144347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      +WT+eE+  ++ + ++lG+g+W+ I+r + ++Rt+ q+ s+ qky
   XP_016515921.1 100 AWTEEEHRTFLVGLEKLGKGDWRGISRNFVTTRTPTQVASHAQKY 144
                      7*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501588.862320IPR001878Zinc finger, CCHC-type
PROSITE profilePS5129417.24793149IPR017930Myb domain
SuperFamilySSF466892.54E-1794149IPR009057Homeodomain-like
SMARTSM007172.6E-1097147IPR001005SANT/Myb domain
TIGRFAMsTIGR015572.0E-1797147IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.603.5E-1198143IPR009057Homeodomain-like
CDDcd001673.78E-9100145No hitNo description
PfamPF002491.6E-11100144IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 265 aa     Download sequence    Send to blast
MRRKCSHCGK IGHNSRTCTS FRVGVISCGL RLFGVQVLDN ISSSSSSSSS SSSSSSHDIH  60
LKKSLSLDCL SSSEKTSCTN GSLSDCLLGQ AHQHRRKGVA WTEEEHRTFL VGLEKLGKGD  120
WRGISRNFVT TRTPTQVASH AQKYFLRLST HHLINSKKRR SSLFDLVRSN NKNHLDAITD  180
YINTKPDYAN SLTGITSLNE VCQETSLSNL MDLNSASHQM VMSSSTIMSN SPVAAALDLE  240
LSLAAPTNVD KSKPNTFLIG PIPVT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016515921.10.0PREDICTED: protein REVEILLE 4-like
SwissprotQ8S9H71e-28DIV_ANTMA; Transcription factor DIVARICATA
TrEMBLM1AKK62e-79M1AKK6_SOLTU; Uncharacterized protein
STRINGPGSC0003DMT4000247562e-67(Solanum tuberosum)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA33852147
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G56840.11e-44MYB_related family protein